Loading...
Statistics
Advertisement

Kit & Wolfe
www.kitandwolfe.com/

Kitandwolfe.com

Advertisement
Conversion Technology Metas Server
Kitandwolfe.com is hosted in Canada / Ottawa . Kitandwolfe.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Html5, Number of used javascripts: 5. First javascripts: Express_buttons...fc61971.js, Modernizr.min.js, Jquery.min.js, Number of used analytics tools: 0. Its server type is: nginx. Its CMS is: Shopify.

Technologies in use by Kitandwolfe.com

Technology

Number of occurences: 6
  • CSS
  • Html
  • Html5
  • Javascript
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 5
  • express_buttons-24331cc818fb0ba6c34123458b4334e8a33a58f5511580c1b8026f7f7fc61971.js
  • modernizr.min.js
  • jquery.min.js
  • magnific-popup.min.js
  • social-buttons.js

Content Management System

Number of occurences: 1
  • Shopify

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Kitandwolfe.com

SSL certificate

    • name: /CN=kitandwolfe.com
    • subject:
      • CN: kitandwolfe.com
    • hash: ee1d3e6d
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 309142893002440567988537133118195707420824
    • validFrom: 160814012200Z
    • validTo: 161112012200Z
    • validFrom_time_t: 1471137720
    • validTo_time_t: 1478913720
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 0C:D7:E9:75:8E:52:7D:5D:9D:C7:33:28:E4:0D:39:3F:B3:72:F0:1E
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:kitandwolfe.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Kitandwolfe.com

Number of occurences: 3
  • Name:
    Content:
  • Name: viewport
    Content: width=device-width,initial-scale=1,minimum-scale=1
  • Name: twitter:card
    Content: summary

Server / Hosting

  • IP: 23.227.38.71
  • Latitude: 45.42
  • Longitude: -75.69
  • Country: Canada
  • City: Ottawa

Rname

  • ns1.systemdns.com
  • ns2.systemdns.com
  • ns3.systemdns.com
  • mx.kitandwolfe.com.cust.b.hostedemail.com

Target

  • hostmaster.systemdns.com

HTTP Header Response

HTTP/1.1 302 Found Server: nginx Date: Fri, 30 Sep 2016 14:15:52 GMT Content-Type: text/html; charset=utf-8 X-Frame-Options: DENY X-ShopId: 11334654 X-ShardId: 9 Content-Language: en X-Cache: allow Location: http://www.kitandwolfe.com/password Content-Security-Policy-Report-Only: default-src 'self' *; connect-src 'self' * wss:; font-src 'self' * data:; frame-src 'self' * shopify-pos:; img-src 'self' * data:; media-src 'self' *; object-src 'self' *; script-src 'self' * 'unsafe-inline' 'unsafe-eval'; style-src 'self' * 'unsafe-inline'; frame-ancestors www.kitandwolfe.com; report-uri /csp-report/2e6da553-25b1-4364-973b-49c6aec2ddb4?source%5Baction%5D=index&source%5Bcontroller%5D=storefront_section%2Fshop&source%5Bsection%5D=storefront; X-XSS-Protection: 1; mode=block; report=/xss-report/2e6da553-25b1-4364-973b-49c6aec2ddb4?source%5Baction%5D=index&source%5Bcontroller%5D=storefront_section%2Fshop&source%5Bsection%5D=storefront X-Request-Id: 2e6da553-25b1-4364-973b-49c6aec2ddb4 P3P: CP="NOI DSP COR NID ADMa OPTa OUR NOR" X-Dc: ash Set-Cookie: _orig_referrer=; Expires=Fri, 14-Oct-16 14:15:52 GMT; Path=/; HttpOnly Set-Cookie: _landing_page=%2F; Expires=Fri, 14-Oct-16 14:15:52 GMT; Path=/; HttpOnly X-Download-Options: noopen X-Permitted-Cross-Domain-Policies: none X-Content-Type-Options: nosniff X-Content-Type-Options: nosniff X-Cache: MISS from s_ub15 Transfer-Encoding: chunked Via: 1.1 s_ub15 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Server: nginx Date: Fri, 30 Sep 2016 14:15:52 GMT Content-Type: text/html; charset=utf-8 Vary: Accept-Encoding Vary: Accept-Encoding X-ShopId: 11334654 X-ShardId: 9 Content-Language: en Content-Security-Policy-Report-Only: default-src 'self' *; connect-src 'self' * wss:; font-src 'self' * data:; frame-src 'self' * shopify-pos:; img-src 'self' * data:; media-src 'self' *; object-src 'self' *; script-src 'self' * 'unsafe-inline' 'unsafe-eval'; style-src 'self' * 'unsafe-inline'; frame-ancestors www.kitandwolfe.com; report-uri /csp-report/216b5115-2b66-4e40-a4d7-805a25d7f8b3?source%5Baction%5D=password&source%5Bcontroller%5D=storefront_section%2Fstorefront&source%5Bsection%5D=storefront; X-XSS-Protection: 1; mode=block; report=/xss-report/216b5115-2b66-4e40-a4d7-805a25d7f8b3?source%5Baction%5D=password&source%5Bcontroller%5D=storefront_section%2Fstorefront&source%5Bsection%5D=storefront ETag: cacheable:c6d72280f79e8a5d6557a0c2b26af6b4 X-Alternate-Cache-Key: cacheable:26137a80a53ebce3885ac9c8c5346b77 X-Cache: miss Set-Cookie: _orig_referrer=http%3A%2F%2Fwww.kitandwolfe.com%2F; Expires=Fri, 14-Oct-16 14:15:52 GMT; Path=/; HttpOnly X-Request-Id: 216b5115-2b66-4e40-a4d7-805a25d7f8b3 P3P: CP="NOI DSP COR NID ADMa OPTa OUR NOR" X-Dc: ash Set-Cookie: customer_sig=; path=/; expires=Tue, 30 Sep 2036 14:15:52 -0000; HttpOnly Set-Cookie: _landing_page=%2Fpassword; Expires=Fri, 14-Oct-16 14:15:52 GMT; Path=/; HttpOnly Set-Cookie: _session_id=547dfc45fab2f3f800f872d0298200bb; path=/; HttpOnly Set-Cookie: cart_sig=; path=/; expires=Fri, 14 Oct 2016 14:15:52 -0000; HttpOnly X-Download-Options: noopen X-Permitted-Cross-Domain-Policies: none X-Content-Type-Options: nosniff X-Content-Type-Options: nosniff X-Cache: MISS from s_ub15 Transfer-Encoding: chunked Via: 1.1 s_ub15 (squid/3.5.20) Connection: keep-alive

DNS

host: kitandwolfe.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 23.227.38.32
host: kitandwolfe.com
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns1.systemdns.com
host: kitandwolfe.com
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns2.systemdns.com
host: kitandwolfe.com
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns3.systemdns.com
host: kitandwolfe.com
  1. class: IN
  2. ttl: 300
  3. type: SOA
  4. mname: ns1.systemdns.com
  5. rname: hostmaster.systemdns.com
  6. serial: 8675314
  7. refresh: 10800
  8. retry: 3600
  9. expire: 1209600
  10. minimum-ttl: 3600
host: kitandwolfe.com
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 0
  5. target: mx.kitandwolfe.com.cust.b.hostedemail.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.itandwolfe.com, www.ktitandwolfe.com, www.titandwolfe.com, www.kitandwolfe.com, www.itandwolfe.com, www.kgitandwolfe.com, www.gitandwolfe.com, www.kbitandwolfe.com, www.bitandwolfe.com, www.knitandwolfe.com, www.nitandwolfe.com, www.khitandwolfe.com, www.hitandwolfe.com, www.kyitandwolfe.com, www.yitandwolfe.com, www.klitandwolfe.com, www.litandwolfe.com, www.koitandwolfe.com, www.oitandwolfe.com, www.kuitandwolfe.com, www.uitandwolfe.com, www.kiitandwolfe.com, www.iitandwolfe.com, www.kmitandwolfe.com, www.mitandwolfe.com, www.ktandwolfe.com, www.kirtandwolfe.com, www.krtandwolfe.com, www.kiftandwolfe.com, www.kftandwolfe.com, www.kivtandwolfe.com, www.kvtandwolfe.com, www.kiktandwolfe.com, www.kktandwolfe.com, www.ki,tandwolfe.com, www.k,tandwolfe.com, www.kibtandwolfe.com, www.kbtandwolfe.com, www.kigtandwolfe.com, www.kgtandwolfe.com, www.kittandwolfe.com, www.kttandwolfe.com, www.kiytandwolfe.com, www.kytandwolfe.com, www.kiutandwolfe.com, www.kutandwolfe.com, www.kijtandwolfe.com, www.kjtandwolfe.com, www.kimtandwolfe.com, www.kmtandwolfe.com, www.kintandwolfe.com, www.kntandwolfe.com, www.kiandwolfe.com, www.kitqandwolfe.com, www.kiqandwolfe.com, www.kitaandwolfe.com, www.kiaandwolfe.com, www.kit andwolfe.com, www.ki andwolfe.com, www.kitwandwolfe.com, www.kiwandwolfe.com, www.kiteandwolfe.com, www.kieandwolfe.com, www.kitzandwolfe.com, www.kizandwolfe.com, www.kitxandwolfe.com, www.kixandwolfe.com, www.kitcandwolfe.com, www.kicandwolfe.com, www.kitndwolfe.com, www.kitaondwolfe.com, www.kitondwolfe.com, www.kitapndwolfe.com, www.kitpndwolfe.com, www.kita9ndwolfe.com, www.kit9ndwolfe.com, www.kitandwolfe.com, www.kitndwolfe.com, www.kitaindwolfe.com, www.kitindwolfe.com, www.kitaundwolfe.com, www.kitundwolfe.com, www.kitadwolfe.com, www.kitanndwolfe.com, www.kitandwolfe.com, www.kitanhdwolfe.com, www.kitahdwolfe.com, www.kitanjdwolfe.com, www.kitajdwolfe.com, www.kitankdwolfe.com, www.kitakdwolfe.com, www.kitanldwolfe.com, www.kitaldwolfe.com, www.kitan dwolfe.com, www.kita dwolfe.com, www.kitanwolfe.com, www.kitandtwolfe.com, www.kitantwolfe.com, www.kitandgwolfe.com, www.kitangwolfe.com, www.kitandbwolfe.com, www.kitanbwolfe.com, www.kitandxwolfe.com, www.kitanxwolfe.com, www.kitandswolfe.com, www.kitanswolfe.com, www.kitandfwolfe.com, www.kitanfwolfe.com, www.kitandvwolfe.com, www.kitanvwolfe.com, www.kitandywolfe.com, www.kitanywolfe.com, www.kitandzwolfe.com, www.kitanzwolfe.com, www.kitandawolfe.com, www.kitanawolfe.com, www.kitandewolfe.com, www.kitanewolfe.com, www.kitandrwolfe.com, www.kitanrwolfe.com, www.kitandolfe.com, www.kitandw olfe.com, www.kitand olfe.com, www.kitandwcolfe.com, www.kitandcolfe.com, www.kitandwolfe.com, www.kitandolfe.com, www.kitandwdolfe.com, www.kitanddolfe.com, www.kitandwfolfe.com, www.kitandfolfe.com, www.kitandwgolfe.com, www.kitandgolfe.com, www.kitandwbolfe.com, www.kitandbolfe.com, www.kitandwlfe.com, www.kitandwoblfe.com, www.kitandwblfe.com, www.kitandwohlfe.com, www.kitandwhlfe.com, www.kitandwoglfe.com, www.kitandwglfe.com, www.kitandwojlfe.com, www.kitandwjlfe.com, www.kitandwomlfe.com, www.kitandwmlfe.com, www.kitandwo lfe.com, www.kitandw lfe.com, www.kitandwovlfe.com, www.kitandwvlfe.com, www.kitandwofe.com, www.kitandwolufe.com, www.kitandwoufe.com, www.kitandwol8fe.com, www.kitandwo8fe.com, www.kitandwol9fe.com, www.kitandwo9fe.com, www.kitandwoljfe.com, www.kitandwojfe.com, www.kitandwol0fe.com, www.kitandwo0fe.com, www.kitandwolmfe.com, www.kitandwomfe.com, www.kitandwolpfe.com, www.kitandwopfe.com, www.kitandwolofe.com, www.kitandwoofe.com,

Other websites we recently analyzed

  1. 2hover.net
    Switzerland - 141.8.225.72
    Server software: Apache
    Technology: CloudFront, Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 2
  2. 2015 Wedding Dress Fashion Trend Inexpensive Prom Dresses
    2015 fashion wedding dresses under 100, prom dresses, evening dresses collection, the most excellent designers and professional tailors guarantee best custom made dresses.
    Los Angeles (United States) - 155.94.236.167
    Server software: Apache/2.2.15
    Technology: CSS, Html, Javascript, jQuery Validate, Wordpress
    Number of Javascript: 8
    Number of meta tags: 6
  3. Defiance College Apparel, Shop Defiance Gear, Defiance Yellow Jackets Merchandise, Store, Bookstore, Gifts, Tees, Caps, Jerseys
    Defiance College Apparel and Defiance Yellow Jackets Gear from the tremendous Defiance Yellow Jackets fan store. Our Defiance Apparel and merchandise shop will help fans prepare for football, basketball, baseball, and lacrosse season.
    Coppell (United States) - 68.91.160.27
    G Analytics ID: UA-44540413-5
    Server software: Microsoft-IIS/8.5
    Technology: BootstrapCDN, Maxcdn, AdRoll, CSS, Font Awesome, Html, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 3
  4. jeepbrasil.com.br
    Porto Alegre (Brazil) - 186.237.28.4
    Server software: Microsoft-IIS/6.0
    Technology: Html
    Number of meta tags: 1
  5. PLEASANTVIEWFAMILYHEALTHCARE.COM
    Jacksonville (United States) - 205.178.189.131
    Server software: Sun-ONE-Web-Server/6.1
    Technology: Html
    Number of meta tags: 1
  6. 1ï¼…ER TATTOO
    Japan - 210.188.245.26
    Server software: Apache
    Technology: Html, Html5
    Number of meta tags: 1
  7. Medien und Praxishilfen
    Germany - 80.86.88.175
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 4
    Number of meta tags: 2
  8. sandifor.com
    Road Town (Virgin Islands, British) - 208.91.197.25
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  9. danandpro.com
    Scottsdale (United States) - 50.63.202.51
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  10. BeehiveWigs.com
    Kirkland (United States) - 98.124.245.24
    Server software: Apache/2.2.15 (CentOS)
    Technology: Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 3

Check Other Websites