Loading...
Statistics
Advertisement

Alabama Weight Loss Surgery
www.alabamawls.com/

Alabamawls.com

Advertisement
Conversion Technology Metas Server
Alabamawls.com is hosted in United States / San Jose . Alabamawls.com uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 9. First javascripts: Jquery-1.8.2.min.js, Highlight.pack.js, Tabifier.js, Number of used analytics tools: 2. First analytics tools: Facebook Retargeting, Google Analytics, Its server type is: Apache.

Technologies in use by Alabamawls.com

Technology

Number of occurences: 5
  • CSS
  • Font Awesome
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 9
  • jquery-1.8.2.min.js
  • highlight.pack.js
  • tabifier.js
  • jPages.js
  • jquery.lightbox-0.5.js
  • jquery.masked-input.js
  • bmi_code.js
  • customscripts.js
  • bjqs-1.3.min.js

Analytics

Number of occurences: 2
  • Facebook Retargeting
  • Google Analytics

Server Type

  • Apache

Powered by

  • PHP/5.3.29

CDN

Number of occurences: 2
  • BootstrapCDN
  • Maxcdn

Social

Number of occurences: 1
  • Facebook Box

Google Analytics ID

  • UA-50797155-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Alabamawls.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.sykendostore.com
    • subject:
      • OU: Domain Control Validated
      • CN: *.sykendostore.com
    • hash: 5493d2be
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 9681463585493532967
    • validFrom: 160121151238Z
    • validTo: 170121151238Z
    • validFrom_time_t: 1453389158
    • validTo_time_t: 1485011558
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s1-182.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.1 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:*.sykendostore.com, DNS:sykendostore.com
      • subjectKeyIdentifier: EF:68:2E:7F:CC:C7:51:F6:29:9D:DD:96:74:DA:88:95:66:B5:32:88

Meta - Alabamawls.com

Number of occurences: 2
  • Name:
    Content: text/html; charset=utf-8
  • Name: viewport
    Content: width=device-width,initial-scale=1

Server / Hosting

  • IP: 54.241.133.216
  • Latitude: 37.34
  • Longitude: -121.89
  • Country: United States
  • City: San Jose

Rname

  • ns3218.hostgator.com
  • ns3217.hostgator.com
  • aspmx3.googlemail.com
  • aspmx.l.google.com
  • alt1.aspmx.l.google.com
  • alt2.aspmx.l.google.com
  • aspmx2.googlemail.com

Target

  • dnsadmin.gator4004.hostgator.com

HTTP Header Response

HTTP/1.1 200 OK Date: Mon, 25 Apr 2016 00:07:22 GMT Server: Apache X-Powered-By: PHP/5.3.29 Set-Cookie: PHPSESSID=9o6uatsav9rcdj4ovbh3qedha0; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Vary: Accept-Encoding Connection: close Content-Type: text/html; charset=UTF-8

DNS

host: alabamawls.com
  1. class: IN
  2. ttl: 14399
  3. type: A
  4. ip: 54.241.133.216
host: alabamawls.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3218.hostgator.com
host: alabamawls.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3217.hostgator.com
host: alabamawls.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns8007.hostgator.com
  5. rname: dnsadmin.gator4004.hostgator.com
  6. serial: 2016013100
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: alabamawls.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 10
  5. target: aspmx3.googlemail.com
host: alabamawls.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 1
  5. target: aspmx.l.google.com
host: alabamawls.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 5
  5. target: alt1.aspmx.l.google.com
host: alabamawls.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 5
  5. target: alt2.aspmx.l.google.com
host: alabamawls.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 10
  5. target: aspmx2.googlemail.com
host: alabamawls.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx include:websitewelcome.com ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.labamawls.com, www.aolabamawls.com, www.olabamawls.com, www.aplabamawls.com, www.plabamawls.com, www.a9labamawls.com, www.9labamawls.com, www.alabamawls.com, www.labamawls.com, www.ailabamawls.com, www.ilabamawls.com, www.aulabamawls.com, www.ulabamawls.com, www.aabamawls.com, www.aluabamawls.com, www.auabamawls.com, www.al8abamawls.com, www.a8abamawls.com, www.al9abamawls.com, www.a9abamawls.com, www.aljabamawls.com, www.ajabamawls.com, www.al0abamawls.com, www.a0abamawls.com, www.almabamawls.com, www.amabamawls.com, www.alpabamawls.com, www.apabamawls.com, www.aloabamawls.com, www.aoabamawls.com, www.albamawls.com, www.alaobamawls.com, www.alobamawls.com, www.alapbamawls.com, www.alpbamawls.com, www.ala9bamawls.com, www.al9bamawls.com, www.alabamawls.com, www.albamawls.com, www.alaibamawls.com, www.alibamawls.com, www.alaubamawls.com, www.alubamawls.com, www.alaamawls.com, www.alabqamawls.com, www.alaqamawls.com, www.alabwamawls.com, www.alawamawls.com, www.alabzamawls.com, www.alazamawls.com, www.alabxamawls.com, www.alaxamawls.com, www.alabamawls.com, www.alaamawls.com, www.alabsamawls.com, www.alasamawls.com, www.alabyamawls.com, www.alayamawls.com, www.alabeamawls.com, www.alaeamawls.com, www.alabdamawls.com, www.aladamawls.com, www.alabcamawls.com, www.alacamawls.com, www.alabmawls.com, www.alabaomawls.com, www.alabomawls.com, www.alabapmawls.com, www.alabpmawls.com, www.alaba9mawls.com, www.alab9mawls.com, www.alabamawls.com, www.alabmawls.com, www.alabaimawls.com, www.alabimawls.com, www.alabaumawls.com, www.alabumawls.com, www.alabaawls.com, www.alabampawls.com, www.alabapawls.com, www.alabamoawls.com, www.alabaoawls.com, www.alabamiawls.com, www.alabaiawls.com, www.alabamkawls.com, www.alabakawls.com, www.alabam.awls.com, www.alaba.awls.com, www.alabamuawls.com, www.alabauawls.com, www.alabamjawls.com, www.alabajawls.com, www.alabamnawls.com, www.alabanawls.com, www.alabam-awls.com, www.alaba-awls.com, www.alabamwls.com, www.alabamaowls.com, www.alabamowls.com, www.alabamapwls.com, www.alabampwls.com, www.alabama9wls.com, www.alabam9wls.com, www.alabamawls.com, www.alabamwls.com, www.alabamaiwls.com, www.alabamiwls.com, www.alabamauwls.com, www.alabamuwls.com, www.alabamals.com, www.alabamaw ls.com, www.alabama ls.com, www.alabamawcls.com, www.alabamacls.com, www.alabamawls.com, www.alabamals.com, www.alabamawdls.com, www.alabamadls.com, www.alabamawfls.com, www.alabamafls.com, www.alabamawgls.com, www.alabamagls.com, www.alabamawbls.com, www.alabamabls.com, www.alabamaws.com, www.alabamawlus.com, www.alabamawus.com, www.alabamawl8s.com, www.alabamaw8s.com, www.alabamawl9s.com, www.alabamaw9s.com, www.alabamawljs.com, www.alabamawjs.com, www.alabamawl0s.com, www.alabamaw0s.com, www.alabamawlms.com, www.alabamawms.com, www.alabamawlps.com, www.alabamawps.com, www.alabamawlos.com, www.alabamawos.com, www.alabamawl.com, www.alabamawlse.com, www.alabamawle.com, www.alabamawlsw.com, www.alabamawlw.com, www.alabamawlsd.com, www.alabamawld.com, www.alabamawlsx.com, www.alabamawlx.com, www.alabamawlsf.com, www.alabamawlf.com, www.alabamawlsg.com, www.alabamawlg.com, www.alabamawlst.com, www.alabamawlt.com,

Other websites we recently analyzed

  1. medicalmalpracticelawyerpennsylvania.com
    Houston (United States) - 108.167.131.22
    Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips DAV/2 mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  2. EQ Logik - Sönke Wulff
    Germany - 213.203.239.230
    Server software: Apache/2.0.55 (Debian) FrontPage/5.0.2.2635 PHP/4.4.2-1+b1 mod_ssl/2.0.55 OpenSSL/0.9.8c
    Technology: Html
    Number of meta tags: 1
  3. Fasching-Karneval-Shop
    Spezialist für Karneval, Fasching, Halloween Oktoberfest Weihnachten, Nikolaus, Ostern, 60er Jahre, 70er Jahre, 80er Jahre, Mottopartys, Themenpartys, Karnevalskostüme, Faschingskostüme, Perücken, Brillen, Bärte, Jungesellenabschied und Zubehör
    Germany - 62.104.45.105
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery UI
    Number of Javascript: 11
    Number of meta tags: 5
  4. Hoststar - Webspace und Hosting mit vielen Vorteilen - Top Webhosting zum sensationellen Preis
    Wir bieten Ihnen Webhosting, Reseller-Hosting, Domains und vServer für Ihren Internetauftritt bereits ab CHF 5.90 pro Monat.
    Germany - 5.9.101.76
    Server software: Apache
    Technology: CSS, Html, Html5, SVG
    Number of meta tags: 3
  5. Harry Sturm & Associates Inc
    Check out this GoDaddy hosted webpage! http://hsa-recruiting.com.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3
  6. AAU Golf > Home
    United States - 12.179.190.211
    Server software: Redirector/1.0
    Technology: CSS, Html, Javascript, jQuery, jQuery Hover Intent, jQuery UI, comScore, Google Analytics, Google Publisher Tag, DotNetNuke
    Number of Javascript: 12
    Number of meta tags: 7
  7. jelenka.eu - Na úvod
    Czech Republic - 89.185.253.48
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Swf Object
    Number of Javascript: 11
    Number of meta tags: 3
  8. Hi-Tact – Singapore's Scaffolding Solutions
    Singapore - 103.11.189.21
    Server software: Apache
    Technology: CloudFlare, CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, SVG, Wordpress
    Number of Javascript: 12
    Number of meta tags: 3
  9. Lynchburg & Roanoke Hyundai Provider | Robert Woodall Hyundai in Danville
    Make Robert Woodall Hyundai in Danville your Lynchburg and Roanoke source for new and used cars, OEM parts, service & financing!
    Europe - 2.20.189.9
    Server software: squid/3.5.14
    Technology: CSS, Flexslider, Html, Javascript, SVG
    Number of Javascript: 6
    Number of meta tags: 6
  10. oneinstant.com
    Scottsdale (United States) - 184.168.221.32
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe

Check Other Websites